PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_93471g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 792aa    MW: 86374.5 Da    PI: 5.709
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_93471g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-21111166156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++eLe+lF+++++p++++r +++k+l+L++rqVk+WFqNrR+++k
  MA_93471g0010 111 KKRYHRHTPQQIQELEALFKECPHPDEKQRLDISKRLNLETRQVKFWFQNRRTQMK 166
                    688999***********************************************999 PP

2START221.23.4e-692995221206
                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++ ++el+k+a+a+e +W        e +n++e++++f+++ +       +ea r++g+v+ ++ +lve+l+d+  +W+e+++    +a++++
  MA_93471g0010 299 ELALASMDELFKMAQADETLWIPNLdagkETLNYEEYMRQFPSTITpkligLATEATRETGMVITNSLNLVETLMDVD-RWKEMFPcmisRAAMVD 393
                    57899*****************99999**************99999********************************.***************** PP

                    EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vissg      galqlm+aelq+lsplvp R+++f+R+++q+ +g+w++vdvSvds ++++  ++++++++lpSg+li++++ng+skvtwveh+++
  MA_93471g0010 394 VISSGmsgtrnGALQLMYAELQVLSPLVPaREVYFLRFCKQHAEGVWAVVDVSVDSLRDNS-PAGFMKCRRLPSGCLIQDMPNGYSKVTWVEHAEY 488
                    *************************************************************.7********************************* PP

                    -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                    ++r +h l+rsl++sg+a+ga++w+atlqrqce+
  MA_93471g0010 489 DDRGVHRLYRSLLNSGMAFGAQRWLATLQRQCEC 522
                    ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-2093168IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-2196162IPR009057Homeodomain-like
PROSITE profilePS5007117.313108168IPR001356Homeobox domain
SMARTSM003892.2E-19109172IPR001356Homeobox domain
CDDcd000864.68E-19110168No hitNo description
PfamPF000466.1E-19111166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PROSITE profilePS5084845.701290525IPR002913START domain
SuperFamilySSF559613.15E-40293522No hitNo description
CDDcd088752.38E-128294521No hitNo description
PfamPF018524.1E-60299522IPR002913START domain
SMARTSM002344.8E-59299522IPR002913START domain
Gene3DG3DSA:3.30.530.203.5E-5385517IPR023393START-like domain
SuperFamilySSF559611.22E-25552784No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MSFGGFLDSG SGGKLISSSD HNMASGAIAQ PRLVSPGVMP LARPTKNIYT SPGLSLALTS  60
GIEGQGEVGA SVGECEQGKS KDEEYESRSG SDNMDGGSGD DQDAADNPPR KKRYHRHTPQ  120
QIQELEALFK ECPHPDEKQR LDISKRLNLE TRQVKFWFQN RRTQMKTQLE RHENSILRQE  180
NEKLRSENLS IRDAMRNPIC TNCGGPAVLG EMSFEEQQLR IENARLKEEL DRLCALAGKF  240
FGRPVPSMPS VPLMPKSSLD LGVGGMPTSL PSGCADLMHG PAGGRTGNII GIERSMLAEL  300
ALASMDELFK MAQADETLWI PNLDAGKETL NYEEYMRQFP STITPKLIGL ATEATRETGM  360
VITNSLNLVE TLMDVDRWKE MFPCMISRAA MVDVISSGMS GTRNGALQLM YAELQVLSPL  420
VPAREVYFLR FCKQHAEGVW AVVDVSVDSL RDNSPAGFMK CRRLPSGCLI QDMPNGYSKV  480
TWVEHAEYDD RGVHRLYRSL LNSGMAFGAQ RWLATLQRQC ECLAILMATA NVTARDPTAI  540
PTPNGRRSML RLAQRMTDNF CAGVSASTVH TWNKLSGNID DDVRVMTRKS VDDPGEPPGV  600
VLSAATSVWL PVSPQRLFDF LRDERLRSEW DILSNGGPMQ EMAHIPKGQD PGNCVSLLRA  660
SAMNSNQSSS MLILQETCTD ASGSLVVYAP VDIPAMHVVM SGGDPAYVAL LPSGFAILPD  720
GPECRPLALN PSGNGVGVNS PRVGGSLLTV AFQILVNSLP TAKLTVESVE TVNNLISCTV  780
QKIKAALHCE DA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3288420.0AF328842.1 Picea abies homeodomain protein HB2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002272264.20.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_010661561.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLQ8S5550.0Q8S555_PICAB; Homeodomain protein HB2
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein